PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011604P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 276aa    MW: 31661.1 Da    PI: 6.9419
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011604P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-162572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll ++++ +G g+W++ a++ g++Rt+k+c++rw++yl
   MELO3C011604P1 25 RGPWTIEEDTLLTHYIACHGEGHWNSLAKYAGLKRTGKSCRLRWLNYL 72
                     89********************************************97 PP

2Myb_DNA-binding54.23.3e-1778121146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++E++++++++ ++G++ W++Ia+ ++ gRt++++k++w++
   MELO3C011604P1  78 RGNFTPQEQLIILELHSKWGNR-WSKIAQQLP-GRTDNEIKNYWRT 121
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2422072IPR017930Myb domain
SuperFamilySSF466897.49E-3123119IPR009057Homeodomain-like
SMARTSM007174.2E-122474IPR001005SANT/Myb domain
PfamPF002493.8E-152572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-232679IPR009057Homeodomain-like
CDDcd001678.14E-92772No hitNo description
PROSITE profilePS5129425.68373127IPR017930Myb domain
SMARTSM007176.4E-1677125IPR001005SANT/Myb domain
PfamPF002494.1E-1678121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2580126IPR009057Homeodomain-like
CDDcd001678.61E-1180121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MESVRRSPIN NNNNHNASAE NEVRRGPWTI EEDTLLTHYI ACHGEGHWNS LAKYAGLKRT  60
GKSCRLRWLN YLKPDIKRGN FTPQEQLIIL ELHSKWGNRW SKIAQQLPGR TDNEIKNYWR  120
TRVEKQAKQL NIESNSKKFL ETVRDLWIPM LLQKMDQKPS SPSSSNYSPL SLGETFYQNS  180
CGSSSSEHTI EAKQNSIQSC GGYYQWPESY ARVSEEFENN SDVRNNNNGG FLQMDQLQHP  240
FSLLGATCGG AEFDGHMVAS DWVFQDDVSE TFWNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-252212724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818170.0LN681817.1 Cucumis melo genomic scaffold, anchoredscaffold00015.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445685.10.0PREDICTED: transcription factor MYB108-like
TrEMBLA0A0A0KC911e-163A0A0A0KC91_CUCSA; Uncharacterized protein
STRINGVIT_01s0011g03730.t013e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-78myb domain protein 62